DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:291 Identity:90/291 - (30%)
Similarity:129/291 - (44%) Gaps:45/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGG 66
            |..|.|.|.:....:.:..||..:..|   .:|.|||.|..|..|..|:.|.|  .|..|.:|||
Zfish     4 KTCVTLLLLMYVRDSLSNLQVCGRPNP---TLNPRIVGGVNATHGAWPWMVSL--QGRYGHFCGG 63

  Fly    67 SIIAHDWVLTAAHC--TNGASQVTIYYGATWRTNAQFTHTVGS--GDFIQNHNWPN-QNGNDIAL 126
            |:|.:.||||||||  ....|.:.:|.| .||:.....:::..  ...|.:.::.| ...|||||
Zfish    64 SLINNQWVLTAAHCIVDQTPSSIIVYLG-KWRSYVADVNSISRTIRHIIPHPSYSNITKDNDIAL 127

  Fly   127 IR-TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWG----LTTAG-----------SQPDWM 175
            :: |..|.:...:..:.|...|..:....|.|  ..|||    |.|.|           ..|..:
Zfish   128 LQLTSTVQYTDYIKPICLADENSNFPRGTNSW--VAGWGDIGVLGTGGIRGRTTVSVPLPHPGIL 190

  Fly   176 ECVDLQIISNSECSR-TYGTQPDGILCVST-SGGKSTCSGDSGGPLVLHDGGRLVGVTSWVS--- 235
            :..:|::.||::|:. .:|.....::|..| .|||:|.||||||||       :...:.||.   
Zfish   191 QEAELKVYSNADCNNICHGRITPNMICAGTRPGGKATFSGDSGGPL-------MTKCSVWVQAGV 248

  Fly   236 ---GNGCT-AGLPSGFTRVTNQLDWIRDNSG 262
               |.||. ..||..|.||:....||..|.|
Zfish   249 LSHGYGCAQPNLPEVFIRVSEYKQWITGNVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 78/250 (31%)
Tryp_SPc 37..260 CDD:238113 79/252 (31%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.