DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and ctrb2

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:238 Identity:77/238 - (32%)
Similarity:119/238 - (50%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ING--RIVNGYPAYEGKAPYTVGL----GFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYY 91
            |:|  |||||..|..|..|:.|.|    ||.     :||||::.:.||:|||||....|...|..
 Frog    28 ISGYARIVNGENAVSGSWPWQVSLQDRTGFH-----FCGGSLVNNLWVVTAAHCGVTTSHRVILG 87

  Fly    92 GATWRTNAQFTHTVGSGDFIQNHNWPNQNG--NDIALIR-TPHVDFWHMVNKVELPSFNDRYNMY 153
            .....::|:...|:......::.|: |.|.  |||.|:: :....|...|..|.:|:.::.:|..
 Frog    88 EYDRSSSAEPIQTMSISRVFKHPNY-NTNTMINDITLLKLSSTASFNSRVAPVCIPTSSEVFNSP 151

  Fly   154 DNYWAVACGWGLTTAGSQ--PDWMECVDLQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSG 216
            :.  .:..|||...|.|:  |:.::.|.|.::||:||.|.:|.:....:..:.:.|.|:|.||||
 Frog   152 ER--CITTGWGYVDAYSKLSPNKLQQVTLPLLSNTECQRYWGNKIHSTMICAGASGASSCMGDSG 214

  Fly   217 GPLVLHDGGR--LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
            ||||....|.  |.|:.||.|.. |:...|..:.||:....|:
 Frog   215 GPLVCARNGAWVLAGIVSWGSST-CSPSSPGVYARVSTLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 74/231 (32%)
Tryp_SPc 37..260 CDD:238113 74/232 (32%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.