DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and prss27

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:260 Identity:78/260 - (30%)
Similarity:120/260 - (46%) Gaps:53/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHC---TNGASQVTIYYGAT 94
            ::.||:.|..|.||:.|:.|  .|..|||.:|||::|:..:|::||||   ::.||.||...||.
 Frog    30 VSSRIMGGQSAQEGQWPWQV--SFRNNGGHFCGGTLISKQYVISAAHCFPSSSSASSVTAVLGAY 92

  Fly    95 W-------------RTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR--TPHVDFWHMVNKVELP 144
            .             ::...:...|..||           ..||:|::  :| |.|.:.:..|.||
 Frog    93 MIDQPDGNQVAIPVQSATNYPSYVNEGD-----------SGDISLVQLASP-VTFTNYILPVCLP 145

  Fly   145 SFNDRYNMYDNYWAVACGWGLTTAG---SQPDWMECVDLQIISNSECS------RTYGTQP---- 196
            :....:......|..  |||...:.   ..|..::.|.:.:|..:||:      .:|||..    
 Frog   146 ADTVTFPTGLQCWVT--GWGNIASDVSLVSPMTLQEVAVPLIDANECNALYQTPNSYGTSSISVH 208

  Fly   197 DGILCVS-TSGGKSTCSGDSGGPLVLHDGGR--LVGVTSWVSGNGC-TAGLPSGFTRVTNQLDWI 257
            ..::|.. .:|||.:|.||||||||....|:  |.||.|:  |.|| .|..|..:|.:.:..|||
 Frog   209 SDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSF--GEGCGQAYRPGVYTLMPSYTDWI 271

  Fly   258  257
             Frog   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 76/255 (30%)
Tryp_SPc 37..260 CDD:238113 77/256 (30%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 75/254 (30%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.