DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and ctrl

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:234 Identity:76/234 - (32%)
Similarity:115/234 - (49%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ING--RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATW 95
            |:|  |||||..|..|..|:.|.|..| ||..:||||:|...||:|||||...|....:..|...
Zfish    26 ISGYNRIVNGENAVSGSWPWQVSLQQS-NGFHFCGGSLINQYWVVTAAHCRVQAGYHYVILGEHD 89

  Fly    96 R-TNAQFTHTVGSGDFIQNHNWPNQN-GNDIALIR-TPHVDFWHMVNKVELPSFNDRYNMYDNYW 157
            | ::|:..........|.:..:.:|| .|||.|:: :........::.|.|.:.:.  ::.....
Zfish    90 RGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSSPAQLTSRISPVCLAASST--SIPSGTR 152

  Fly   158 AVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQ--PDGILCVSTSGGKSTCSGDSGGPLV 220
            .|..|||.|.:.|.|..::...|.::|.::|.:.:|..  .|.::|...| |.|:|.||||||||
Zfish   153 CVTTGWGKTGSTSSPRILQQTALPLLSPAQCKQYWGQNRITDAMICAGAS-GVSSCQGDSGGPLV 216

  Fly   221 LHDGGR--LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
            ....|.  .||:.||.:.: |....|:.:.||:....||
Zfish   217 CESSGAWYQVGIVSWGTSD-CNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 72/227 (32%)
Tryp_SPc 37..260 CDD:238113 73/228 (32%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 72/227 (32%)
Tryp_SPc 32..257 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.