DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG9737

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:108/275 - (39%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWR 96
            ::..||..|..|...:.|:...|.::.| .:.|.|::|....:||||||..|...         |
  Fly   145 QVTNRIYGGEIAELDEFPWLALLVYNSN-DYGCSGALIDDRHILTAAHCVQGEGV---------R 199

  Fly    97 TNAQFTHTVGSGDF--------IQNHNW------------------------PNQNGNDIALIRT 129
            ......| |..|:|        |:..|:                        .|...||||:||.
  Fly   200 DRQGLKH-VRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL 263

  Fly   130 PH-VDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQ-------PDWMECVDLQIISNS 186
            .| |.|.|.|..:.||:.::...:.:.......|||.|...::       |..:: :.:..:||.
  Fly   264 KHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK-LRIPYVSNE 327

  Fly   187 ECSRT---YGTQ--PDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCT----AG 242
            .|::.   :|.:  |..| |......|.||:|||||||:..|......|...|...|.|    ||
  Fly   328 NCTKILEGFGVRLGPKQI-CAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAG 391

  Fly   243 LPSGFTRVTNQLDWI 257
            .|:.:|.|....|||
  Fly   392 KPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 71/269 (26%)
Tryp_SPc 37..260 CDD:238113 72/270 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 71/269 (26%)
Tryp_SPc 150..409 CDD:238113 72/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.