DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG11843

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:110/267 - (41%) Gaps:71/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVNGYPAYEGKAPYTVGLGF----SGNGGWWCGGSIIAHDWVLTAAHCTNG-ASQVTI------- 89
            ||.|:||...:.|:...||.    |....|:|||.:|:..:|||||||... ..:|.:       
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132

  Fly    90 -----------------YYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR-TPHVDFWH 136
                             |.......:.||.|                   ||.|:: |..|.|..
  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYH-------------------DIGLVKLTEAVVFDL 178

  Fly   137 MVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPD-WMECVDLQIISNSECSRTYGTQ----P 196
            ..:...||..::|.:  |::  :|.|||.|....:|. .:..|.||...|..|.:....|    |
  Fly   179 YKHPACLPFQDERSS--DSF--IAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFP 239

  Fly   197 DGI-----LCVSTSGGKSTCSGDSGGPLVLHDGGR-----LVGVTSWVSGNGC-TAGLPSGFTRV 250
            .|.     |||.:...:.||:|||||||:::....     :||:||  :|..| :.|:|..:|||
  Fly   240 RGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITS--AGLSCGSPGIPGIYTRV 302

  Fly   251 TNQLDWI 257
            ...|.||
  Fly   303 YPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 74/265 (28%)
Tryp_SPc 37..260 CDD:238113 76/267 (28%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 76/267 (28%)
Tryp_SPc 68..309 CDD:214473 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.