DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG4815

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:100/270 - (37%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLALALAAVSAET------VQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTV----GLG---F 56
            |.|.|.|.:|..|.      ..:.||           ||.||...       ||    |:|   |
  Fly     8 VRLLLILNSVRTEAGNREEWTGRFHP-----------RIYNGIKT-------TVESLGGVGIQLF 54

  Fly    57 SGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVG--SGDFIQNHNWPNQ 119
            :|. ...|..:::....:||||||....::            ::| |.:|  |.:|    .|...
  Fly    55 NGR-KLVCSATLLTPRHILTAAHCFENLNR------------SKF-HVIGGKSAEF----TWHGN 101

  Fly   120 NGNDIALIRTP-HVDFWHMVNKVELPSFNDRYNMYDNYWA---------------VACGWGLTTA 168
            |.|...|||.. |..:..|....::.....:|.:...|..               :|.|||....
  Fly   102 NFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGG 166

  Fly   169 ---GSQPDWMECVDLQIISNSECSRTYGTQ-PDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVG 229
               .|:......:.:.|:|..:|.:....: |..|:|......|:.|.|||||||:|  |.::.|
  Fly   167 VWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLL--GRQVCG 229

  Fly   230 VTSWV--SGN 237
            :.:|.  .||
  Fly   230 INTWTFKCGN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 58/233 (25%)
Tryp_SPc 37..260 CDD:238113 57/232 (25%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 51/211 (24%)
Trypsin 49..256 CDD:278516 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.