DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and SPE

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:268 Identity:79/268 - (29%)
Similarity:110/268 - (41%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGLG----FSGNGGWWCGGSIIAHDWVLTAAHC-------TNGASQVTI 89
            ||..|......:.|:.|.|.    ||....:.|||:::...:||||.||       .:||...::
  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198

  Fly    90 YYGATW--RTNAQFTHTVGSGD---------------FIQNHNWPN--QNGNDIALIRTPH-VDF 134
            ..| .|  ||:...| |..:|.               .|.....||  ...|||||:|... |.:
  Fly   199 RLG-EWDTRTDPDCT-TQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSY 261

  Fly   135 WHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISN----SECSRTYGT- 194
            ...|..:.||:.....|.:.:|.....|||| |...||   ..:.|:|..|    :.|...|.: 
  Fly   262 TDYVRPICLPTDGLVQNNFVDYGMDVAGWGL-TENMQP---SAIKLKITVNVWNLTSCQEKYSSF 322

  Fly   195 ---QPDGILCVSTSGGKSTCSGDSGGPLV--LHDGGR----LVGVTSWVSGNGCTAGLPSGFTRV 250
               ..|..:|.....|..||.|||||||:  :..|||    :.||||:.:......|.|..:||.
  Fly   323 KVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRT 387

  Fly   251 TNQLDWIR 258
            ...:|||:
  Fly   388 GAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 77/265 (29%)
Tryp_SPc 37..260 CDD:238113 78/267 (29%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 78/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.