DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG16710

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:116/293 - (39%) Gaps:83/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPKDTKINGRIVNGYPAYEG------KAPYTVGLGFSGNG-GWW-------CGGSIIAHDWVLTA 77
            || :|:|.|.|:..|..:.|      :.|:...:.::... ..|       |.||:|.:.:||||
  Fly    91 LP-NTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTA 154

  Fly    78 AHCTNGASQVTIYYGATWRTNAQFTHTVGSG-DFIQNHN-------------------------W 116
            |||.    ::|   |...|......|.:.|. |.:.:.|                         :
  Fly   155 AHCL----RIT---GLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVF 212

  Fly   117 PNQNGNDIALIRTPH-VDFWHMVNK--VEL------PSFNDRYNMYDNYWAVACGWGLTTAGSQP 172
            ..:..|||||:|... |.:...:..  |:|      |||:       |:.....||||    |..
  Fly   213 EERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFS-------NHKLQIAGWGL----SHK 266

  Fly   173 DWMECVDLQIISN----SECS---RTYGTQPDGILCVSTSGGKSTCSGDSGGPL--VLHDGGR-- 226
            .....|.||...|    .|||   .:.|...:..:|....||..||.|||||||  ::..|..  
  Fly   267 QGYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEF 331

  Fly   227 --LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
              |.|:||: ..:.|..| |:.:|:.:..::||
  Fly   332 VYLAGITSY-GYSQCGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 70/282 (25%)
Tryp_SPc 37..260 CDD:238113 72/283 (25%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 68/276 (25%)
Tryp_SPc 106..362 CDD:238113 68/275 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.