DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG31219

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:276 Identity:62/276 - (22%)
Similarity:97/276 - (35%) Gaps:89/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NGYPAYEGKAPYTVGLGFSGNGGW----------------WCGGSIIAHDWVLTAAHCTNG---- 83
            ||||                   |                :|.||:|.:.:|||:|||.||    
  Fly    98 NGYP-------------------WMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRD 143

  Fly    84 -------ASQVTIYYGATWRTNAQ------------------FTHTVGSGDFIQNHNWPNQNGND 123
                   ..:..|.|...:..:.:                  ..|.:.|.  |.|.|..    .|
  Fly   144 LSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSS--ISNRNIE----YD 202

  Fly   124 IALIRTP-HVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSE 187
            |||:|.. .|.:...:..:.:|    ::..:........|||.|..|.....:....::..|.:.
  Fly   203 IALLRLKMPVRYRTGIMPICIP----KHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAV 263

  Fly   188 CSRTY-------GTQPDGILCVSTSGGKSTCSGDSGGPLVL---HDGGRLVGVTSWVSGNGCTAG 242
            |:..:       ..|    :|.....|..||.|||||||::   :....|.|:|::.|.|....|
  Fly   264 CALRFPYLDLNQSLQ----ICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIG 324

  Fly   243 LPSGFTRVTNQLDWIR 258
            :|..:||.:..|.||:
  Fly   325 IPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 60/273 (22%)
Tryp_SPc 37..260 CDD:238113 62/276 (22%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 60/273 (22%)
Tryp_SPc 90..342 CDD:238113 62/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.