DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG17475

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:282 Identity:87/282 - (30%)
Similarity:120/282 - (42%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLALALAAVSAETVQQVHPKDLPKD-----TKING-----RIVNGYPAYEGKAPYTVGLGFS 57
            |..:|.:.||....:.:..|....|.:|     :|..|     |::||.....|:|.|.:.|  .
  Fly     6 VVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISL--Q 68

  Fly    58 G-NGGWWCGGSIIAHDWVLTAAHCTNGASQV-------TIYY---GATWRTNAQFTHTVGSGDFI 111
            | .||..|||.||....|||||||..|.:..       |:.|   .|.:.....:.|.       
  Fly    69 GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHC------- 126

  Fly   112 QNHNWPNQNGNDIALIR-TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTA-GSQPDW 174
             |:|.|:.: ||||||| ...:.|.......|||:    ..:.:....:..|||.|.. |..||.
  Fly   127 -NYNSPDYH-NDIALIRLNDTIKFNEYTQPAELPT----APVANGTQLLLTGWGSTELWGDTPDI 185

  Fly   175 MECVDLQIISNSECSRTYGTQPDG---ILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSG 236
            ::...|..:..|.|.......|..   .:|..|:||:..|.|||||||. |: |.|.|:.:|  |
  Fly   186 LQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLT-HN-GVLYGLVNW--G 246

  Fly   237 NGCTAGLPSGFTRVTNQLDWIR 258
            ..|..|:|.....|...|:|||
  Fly   247 YPCALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 75/236 (32%)
Tryp_SPc 37..260 CDD:238113 77/238 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 75/236 (32%)
Tryp_SPc 50..269 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.