DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG3505

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:230 Identity:67/230 - (29%)
Similarity:95/230 - (41%) Gaps:42/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGSIIAHDWVLTAAHCTNGAS----QVTIYYGATWRT----NAQFTHTVGSGDF---------- 110
            |||.:|:..:|||||||...|:    |:|......|.|    :.|:.......|.          
  Fly   137 CGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIE 201

  Fly   111 -IQNHNWPNQNG----NDIALIRTPHV----DFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLT 166
             :..|...|:..    |||||:|....    ||   |..:.||:...|.:..::......||   
  Fly   202 ELLPHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTEVAGW--- 260

  Fly   167 TAGSQPDWMECVDLQIISNSECSRTYGTQPDGI----LCVSTSGGKSTCSGDSGGPLVL--HDGG 225
             ..|....|....:.|.|..||.|.|.:|...|    ||..|:  ...|.|::||||:|  :||.
  Fly   261 -QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTN--SQECYGNAGGPLMLFKNDGY 322

  Fly   226 RLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDN 260
            .|.|:.|:..........|..:|||.:.:|||.|:
  Fly   323 LLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 64/225 (28%)
Tryp_SPc 37..260 CDD:238113 66/228 (29%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 66/227 (29%)
Tryp_SPc 111..354 CDD:214473 64/225 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.