DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and snk

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:319 Identity:83/319 - (26%)
Similarity:132/319 - (41%) Gaps:103/319 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLALALAAVSAE----TVQQVHPKDLPKDTKINGR--------IVNGYPAYEGKAPYTVGLGFSG 58
            |||..::|...:    ..:::|..|..:  ..:|:        ||.|.|...|..|:...||::.
  Fly   145 VLAQRISATKCQEYNAAARRLHLTDTGR--TFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQ 207

  Fly    59 NGG-------WWCGGSIIAHDWVLTAAHCTN-----------GASQVT-------------IYYG 92
            ..|       |.|||::::..:|||||||..           ||.|:.             |...
  Fly   208 GSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETSATQQDIKILIIVLH 272

  Fly    93 ATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR-TPHVDFWHMVN--------KVELPSFND 148
            ..:|::|.:                    :||||:: |..|.|...|.        ::::|:   
  Fly   273 PKYRSSAYY--------------------HDIALLKLTRRVKFSEQVRPACLWQLPELQIPT--- 314

  Fly   149 RYNMYDNYWAVACGWGLTT-AGSQPDWMECVDLQIISNSECSRTYGTQ---PDGIL----CVS-T 204
                     .||.|||.|. .|::.:.:..|||.::....|.:.|..:   |.||:    |.. .
  Fly   315 ---------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYL 370

  Fly   205 SGGKSTCSGDSGGPL--VLHD---GGRLVGVTSWVSGNGCTA-GLPSGFTRVTNQLDWI 257
            .||:.||.||||||:  :|.:   ...:||:||:  |..|.| ..|..:||:.:.||||
  Fly   371 PGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSF--GKFCAAPNAPGVYTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 74/283 (26%)
Tryp_SPc 37..260 CDD:238113 76/276 (28%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 76/276 (28%)
Tryp_SPc 186..427 CDD:214473 74/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.