DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG16749

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:88/237 - (37%)
Similarity:126/237 - (53%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRIVNGYPAYEGKAPYTVGL-GFSGNGGWWCGGSIIAHDWVLTAAHCTNG--ASQVTIYYGATWR 96
            ||:|||..:...|.|:.:.: |.||:..  ||||||:..:|:||||||:|  ||.:::.||.| :
  Fly    28 GRVVNGTDSSVEKYPFVISMRGSSGSHS--CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVT-K 89

  Fly    97 TNAQFTHTVGSGDFIQ--NHNWPNQNGNDIA--LIRTPHVDFWHMVNKVELPSFNDRYNMYD-NY 156
            .||...:.|.....||  ::|..|...|||:  |:..|.......|..|:||.........| ..
  Fly    90 INATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGG 154

  Fly   157 WAVACGWGL-TTAGSQPDWMECVDLQIISNSECSRTYG--TQPDGILCVST-SGGKSTCSGDSGG 217
            ..|..|||| .|.|.....::.|:|::.|:.||:..:|  |.|...:|... .|||..|||||||
  Fly   155 EGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGG 219

  Fly   218 PLVLHDGGRLVGVTSWVSGNGCT-AGLPSGFTRVTNQLDWIR 258
            ||:.:  |:.||:.|| |...|| |..|..:.:|:..:|||:
  Fly   220 PLIYN--GQQVGIVSW-SIKPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 85/233 (36%)
Tryp_SPc 37..260 CDD:238113 86/235 (37%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 85/233 (36%)
Tryp_SPc 30..259 CDD:238113 86/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.