DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and MP1

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:289 Identity:79/289 - (27%)
Similarity:119/289 - (41%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PKDLPKDTKING----------------RIVNGYPAYEGKAPYTVGLGFSGNG---GWWCGGSII 69
            |....|.||.:|                |:|.|....:.:.|:...:.::..|   |..||||:|
  Fly   109 PTQTTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLI 173

  Fly    70 AHDWVLTAAHCTNGAS---QVTIYYGATWRTNAQFTHTVGSG----------DF-----IQNHNW 116
            .|.:|||||||.:...   ::|......|..:.....|||..          |:     |.:..:
  Fly   174 NHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQY 238

  Fly   117 PNQNG---NDIALIR-TPHVDFWHMVNKVELPSFNDRY-NMYDNYWAVACGWGLTTAGSQPDWME 176
            |..:.   |||||:| ...|.:...:..|.||:...:: |::.....|..|||.|......:...
  Fly   239 PGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL 303

  Fly   177 CVDLQIISNSECSRTYGTQPDGI----LCVSTSGGKSTCSGDSGGPLVLHDGGR------LVGVT 231
            ..:|..:..|||::.|.||...:    :|.....|..:|.|||||||:|.|...      :.||.
  Fly   304 KAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368

  Fly   232 SWVSGNGCTAGLPSGFTRVTNQLDWIRDN 260
            |:........|.|..:|||...|:||.:|
  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIENN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 71/256 (28%)
Tryp_SPc 37..260 CDD:238113 72/258 (28%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 71/256 (28%)
Tryp_SPc 138..397 CDD:238113 72/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.