DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG14088

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:210 Identity:42/210 - (20%)
Similarity:69/210 - (32%) Gaps:57/210 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFT--HTVGSGDFIQNHNW-PNQNGNDIA-- 125
            |::|...::||..||.:....:....|...|..::..  |.|.:  |..|.|: |....|::.  
  Fly    60 GTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAA--FFSNANFNPETQANNMGLM 122

  Fly   126 -LIRT----PHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISN 185
             |:||    .|:....::....:.:|.|..:.::         |.|...|....|......|...
  Fly   123 KLLRTVVYKEHIIPVCILMDSRMQTFADELDYFN---------GTTWKNSDKSPMLRSKTVIRMP 178

  Fly   186 SECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRV 250
            ..|    |....|..|   :|.|...|.|.                            ||| ..:
  Fly   179 QAC----GKLDHGQFC---AGHKDLDSCDE----------------------------PSG-AAL 207

  Fly   251 TNQLDWIRDNSGVAY 265
            |.::|:|..|..|.:
  Fly   208 TREIDYIGPNRTVLF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 39/200 (20%)
Tryp_SPc 37..260 CDD:238113 40/203 (20%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 42/210 (20%)
Tryp_SPc 42..248 CDD:214473 42/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.