DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG18223

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:219 Identity:52/219 - (23%)
Similarity:100/219 - (45%) Gaps:40/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 WCGGSIIAHDWVLTAAHCTNGASQV-------TIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQ- 119
            :|||.||:..::||:|||.....::       .:..|.|.|..::...::...  ::....|:: 
  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNME--VKKIFVPDKF 140

  Fly   120 ---NGNDIAL--------IRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGS--Q 171
               |.|:|||        :..|      :|..:.||:.:....:  ||  ...|||....|.  .
  Fly   141 TVFNTNNIALMMLAKKLPLDNP------LVGVINLPTADPEPGL--NY--TVLGWGRIFKGGPLA 195

  Fly   172 PDWMECVDLQIISNSECSRTYGTQPDGILC---VSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSW 233
            .|.:. :|::::....|.:......:.::|   ::.:..::.|:||:|.||:.::  .:.||.|:
  Fly   196 SDILH-IDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNE--TVFGVVSY 257

  Fly   234 VSGNGCTAGLPSGFTRVTNQLDWI 257
            ..|.| :..|||.:|.|...:|||
  Fly   258 RVGCG-SKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 50/217 (23%)
Tryp_SPc 37..260 CDD:238113 52/219 (24%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 52/219 (24%)
Tryp_SPc 60..280 CDD:214473 50/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.