DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG11529

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:249 Identity:89/249 - (35%)
Similarity:127/249 - (51%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGW----WCGGSIIAHDWVLTAAHCTNGAS 85
            |..|.|:...|:  :.|...| |.||.|.|  .|...|    .|||:::...|:|||.|||.|.:
  Fly    21 KPTPTDSYAVGQ--SKYGRIE-KFPYQVML--IGKQLWRKRILCGGTLLDKRWILTAGHCTMGVT 80

  Fly    86 QVTIYYGATWRTNAQFTHTVG-----SGDFIQNHNW-PNQNGNDIALIRTPH-VDFWHMVNKVEL 143
            ...:|.|.   .:.:.|...|     |..||.:..: |....|||||::.|. |.|...:....|
  Fly    81 HYDVYLGT---KSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASL 142

  Fly   144 PSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQPDGILCVSTSGGK 208
            || ..|::.:.....||.|||.....:..|.|:..:|::|||:||::.|.....|::|......:
  Fly   143 PS-RYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDE 206

  Fly   209 STCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSG 262
            :.|:|||||||||.|...:||:||:...:||...:|.||||||:.||||....|
  Fly   207 TVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 82/231 (35%)
Tryp_SPc 37..260 CDD:238113 84/233 (36%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 83/227 (37%)
Tryp_SPc 37..255 CDD:214473 81/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
87.930

Return to query results.
Submit another query.