DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG3088

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:270 Identity:124/270 - (45%)
Similarity:166/270 - (61%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVV-LALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWC 64
            ||:.|| |.|.|.|..:.......|..:         |.||.|||||:|||.||:.| |....||
  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDHI---------ITNGSPAYEGQAPYVVGMAF-GQSNIWC 55

  Fly    65 GGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGND-IALIR 128
            .|:||...|:||:|.|..|:|.||||:|||..:.||||.|||:.:::        .||. :||:|
  Fly    56 SGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYV--------TGNQHLALVR 112

  Fly   129 TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTT-AGSQPDWMECVDLQIISNSECSRTY 192
            .|.|.|.:.||:|.|||..:|...|:|:||..||||:|| :....|.::||||||:||:||...|
  Fly   113 VPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFY 177

  Fly   193 G--TQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLD 255
            |  |..|.|||..|..|:|||.||:|.||:......:||::::|:.||||.|||:||.|:|:.||
  Fly   178 GSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALD 242

  Fly   256 WIRDNSGVAY 265
            ||...:|:||
  Fly   243 WIHQRTGIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 110/224 (49%)
Tryp_SPc 37..260 CDD:238113 112/226 (50%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 112/225 (50%)
Tryp_SPc 29..244 CDD:214473 110/223 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470793
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.