DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG33460

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:244 Identity:51/244 - (20%)
Similarity:80/244 - (32%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQN 113
            |:|..|  ..:|..:|.|::|...::||||.|.              |.||.   .|..|:|   
  Fly    44 PWTALL--HTDGSIFCAGTLITDVFILTAASCI--------------RPNAV---KVRLGEF--- 86

  Fly   114 HNWPNQNGNDIALIRTPHVDFWHMV----------NKVELPSFNDRYNMYDNYWAVACGWGLTTA 168
            ..:||:...|       |:..:.::          |.:.|.....|..:.|....|..  .|...
  Fly    87 GRYPNELPED-------HLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCI--VLNPQ 142

  Fly   169 GSQPDWMECVDLQIISNSECSRTYGTQPDGI---------------LCVSTSGGKSTCSGDSGGP 218
            ..|...|..:....:.:|..|.|...:|..|               .|....|...:|.|.:|..
  Fly   143 NQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSA 207

  Fly   219 LVLHDGGRLV--------GVTSWVSGNGCTAGLPSGFTRVTNQLDWIRD 259
            |:  ...|.:        |:.: |:...|...  .|:|.|.....||:|
  Fly   208 LI--QNSRYMNKYRHIQFGIAT-VNDMDCEES--QGYTDVLKFYWWIQD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 48/240 (20%)
Tryp_SPc 37..260 CDD:238113 51/244 (21%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 51/244 (21%)
Tryp_SPc 44..249 CDD:214473 48/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.