DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and sphinx2

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:127/287 - (44%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGN-------GGW 62
            :|:||.:.:::....::         .|::.||..||.|......|.||:.::.:       |  
  Fly     3 LVVALLVLSLTFSVCEK---------NKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-- 56

  Fly    63 WCGGSIIAHDWVLTAAHCTNGASQVTIY------YG---ATW--------RTNAQFTHTVGSGDF 110
              .|:||::.|:||       ..:|.|:      :|   |.|        |.|..|.:       
  Fly    57 --AGTIISNQWILT-------VKEVLIFKYIEAHFGSKRAFWGYDILRIYRENFYFHY------- 105

  Fly   111 IQNHNWPNQNGNDIALIRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQ-PDW 174
                    .....|||::.|:..|...:::|.:|::..|:..|.....:.||||......: |.|
  Fly   106 --------DKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTW 162

  Fly   175 MECVDLQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLV-LHDGGRLVGVTSWVSGNG 238
            |.||::::::|:||::.:.......:|.|..|.|..|.||.||.:| :......:|:. |:....
  Fly   163 MRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMPTN 226

  Fly   239 CTAGLPSGFTRVTNQLDWIRDNSGVAY 265
            |:.|.||...||::.:.||:..|||.:
  Fly   227 CSIGYPSVHIRVSDHIKWIKHVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 62/246 (25%)
Tryp_SPc 37..260 CDD:238113 63/248 (25%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 62/246 (25%)
Tryp_SPc 26..248 CDD:304450 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.