DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG10469

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:254 Identity:83/254 - (32%)
Similarity:117/254 - (46%) Gaps:39/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGL--GFSGNGGW--WCGGSIIAHDWVLTAAHCTNGAS----QVTIYYG 92
            ||:||..|...:.||.|||  .|.|:...  .|||:|:::.|::|||||.....    :|.|:.|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    93 ATWRTNAQFTHTVGSGDFIQNHNWP--------NQNGNDIALIRTP-HVDFWHMVNKVELPSFND 148
            .        ..:....:.:.|.::.        ....||||||:.| .:.|...:...:|||.. 
  Fly    88 K--------VKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK- 143

  Fly   149 RYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQ---------PDGILCVST 204
              ..|....|:..||||||.......::.:...||||.||.|.:..|         .:|.:|:.:
  Fly   144 --KTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS 206

  Fly   205 SGGKSTCSGDSGGPLVLHDGGR-LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSG 262
            ..| ..|.||||||:||.||.| |||:.|......|...||...|||::.|.||:..||
  Fly   207 KKG-LPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 79/247 (32%)
Tryp_SPc 37..260 CDD:238113 80/249 (32%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 79/247 (32%)
Tryp_SPc 24..260 CDD:238113 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470939
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.