DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG10472

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:285 Identity:110/285 - (38%)
Similarity:154/285 - (54%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLALALAA----------VSAET-VQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSG 58
            ::||..|.|          ::.|| :.:||.:.||     :|||..|..|...:.||.|||....
  Fly     9 LLLATILGAQAVDWNSVKNLNIETPMPKVHGETLP-----SGRITGGQIAEPNQFPYQVGLLLYI 68

  Fly    59 NGG-WWCGGSIIAHDWVLTAAHCTNG-ASQVTIYYGATWRTNAQ-------FTHTVGSGDFIQNH 114
            .|| .||||:||:..|::||||||:. .:.|.:|.||..||||:       |..|   .:.|.:.
  Fly    69 TGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVET---KNVIVHE 130

  Fly   115 NWPNQN-GNDIALIRTP-HVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWG--LTTAGSQPDWM 175
            :|..:. .|||:||:.| .::|...:...:||..:|.|:.|....|:|.|||  ..:|....|.:
  Fly   131 DWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDIL 195

  Fly   176 ECVDLQIISNSECSRTY-GTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGR-LVGVTSWVSGNG 238
            :...:.|::||.||..| |......:|:.|:||.|||:|||||||||.||.. |:|.||:....|
  Fly   196 QYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALG 260

  Fly   239 CTAGLPSGFTRVTNQLDWIRDNSGV 263
            |..|.|..|||:|..||||.:.|||
  Fly   261 CEVGWPGVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 94/235 (40%)
Tryp_SPc 37..260 CDD:238113 95/237 (40%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 94/235 (40%)
Tryp_SPc 47..282 CDD:238113 95/237 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470895
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.