DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG15873

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:109/290 - (37%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLALA----------LAAVSAETVQQ-VHPKDLPKDTKINGRIVN----GYPAYEGKAPY 50
            :.||:.|.|:          :..:|.||.:. :.....||..:::..:|:    .|..:.|    
  Fly     4 LTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRG---- 64

  Fly    51 TVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNG---ASQ----VTIYYGATWRTNAQFTHTVGSG 108
                     ...:|.|.:::...|||||||...   ||.    :.:.:|...|..........|.
  Fly    65 ---------DNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSV 120

  Fly   109 DFIQNH-NWPNQNGNDIALIR-------TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWG- 164
            |.:..| .:.....||:|::|       :.|.....::.|....::.|.        .:..||| 
  Fly   121 DRLVVHPEYERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDT--------CITLGWGQ 177

  Fly   165 LTTAGSQPDWMECVDLQIISNSECSRTYGT-QPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLV 228
            :...|...:.:..:|:.:...|.|.:.|.| ..|..:|....|....|:||.||||:..  |.|.
  Fly   178 IYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK--GALF 240

  Fly   229 GVTSWVSGN-GCTAGLPSGFTRVTNQLDWI 257
            |:   :.|: ||..|....|.......|||
  Fly   241 GL---IGGHMGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 54/242 (22%)
Tryp_SPc 37..260 CDD:238113 56/243 (23%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 52/239 (22%)
Tryp_SPc 59..250 CDD:238113 49/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.