DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG10764

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:116/271 - (42%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLALALAAVSAETVQQVHPKDLPKDTKINGR--IVNGYPAYEGKAPYTVGLGFSGNGGWW 63
            |:..|.:|| |:.::....:..|.|.|.....|:.|  |..|..|.|..:.:...:..|.:  :.
  Fly     1 MRSLVSVAL-LSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSD--FQ 62

  Fly    64 CGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR 128
            |||:||...:||:||||......:.:..||.........||| ...|:.:....::..|||.|::
  Fly    63 CGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTV-INVFVHHDFIASEYRNDIGLLQ 126

  Fly   129 -TPHVDFWHMVNKVEL---PSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECS 189
             :..:.:...|..:.:   |:..........:.|:  ||| ...|.....::.:.|..:..:||.
  Fly   127 LSESIVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWG-NRNGKLSIMLQTIYLLHLKRNECK 188

  Fly   190 RTYGTQPDG-ILCVSTSGGKSTCSGDSGGPL---VLHDGGR----LVGVTSWVSGNGCTAGLPSG 246
            |......:. .:|..|..| .||.|||||||   :|....:    .:|:.|:........|:   
  Fly   189 RKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGV--- 249

  Fly   247 FTRVTNQLDWI 257
            :|.||:.:|||
  Fly   250 YTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 58/234 (25%)
Tryp_SPc 37..260 CDD:238113 59/233 (25%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 57/232 (25%)
Tryp_SPc 38..263 CDD:238113 59/233 (25%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.