DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Ctrc

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:305 Identity:87/305 - (28%)
Similarity:115/305 - (37%) Gaps:97/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGW--WCGGSI 68
            |||..||..|. ......|.:|      :.|:|.|..|.....|:.|.|.:..:..|  .||||:
  Rat     6 VLAAILACASC-CGNPAFPPNL------STRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSL 63

  Fly    69 IAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSG-----------------DFIQNHN- 115
            |....|||||||                .|..||:.||.|                 |.|..|. 
  Rat    64 ITTSHVLTAAHC----------------INKDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEK 112

  Fly   116 ------WPNQNGNDIALIRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVAC------------- 161
                  |     ||||:|:        :...|||          .|...|||             
  Rat   113 WNRLFLW-----NDIAIIK--------LAEPVEL----------SNTIQVACIPEEGSLLPQDYP 154

  Fly   162 ----GWG-LTTAGSQPDWMECVDLQIISNSECSRT---YGTQPDGILCVSTSGGKSTCSGDSGGP 218
                ||| |.|.|...:.::.....|:|::.|||.   :......::|....|..|.|:||||||
  Rat   155 CYVTGWGRLWTNGPIAEVLQQGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGP 219

  Fly   219 L--VLHDGG-RLVGVTSWVSGNGCTA-GLPSGFTRVTNQLDWIRD 259
            |  ...||. ::.|:.|:.|.:||.. ..|..||||:...|||.:
  Rat   220 LNCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 77/271 (28%)
Tryp_SPc 37..260 CDD:238113 78/274 (28%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 77/271 (28%)
Tryp_SPc 30..265 CDD:238113 78/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.