DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG12133

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:290 Identity:75/290 - (25%)
Similarity:109/290 - (37%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPKDTKINGR------IVNGYPAYEGKAPYTVGLGFSG-----NGGWWCGGSIIAHDWVLTAAHC 80
            || |:::.|:      ||.|..|...:.|:||.||:..     .....|.||:||..:|||||||
  Fly    47 LP-DSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHC 110

  Fly    81 TNGASQVTIYYGA---------------TWRTNAQFTHTVGSGDF-----IQNHNWPNQNG---N 122
            .|    |..:|.|               ||..|..........|.     :.:..:..:||   |
  Fly   111 LN----VNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYN 171

  Fly   123 DIALIR-TPHVDFWHMVNKVEL-PSFNDRYNMYDNYWAVACGWG-------------LTTAGSQP 172
            ||||:| ...|.:...:..:.: |......:.:.|:.....|||             .|.:|..|
  Fly   172 DIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSP 236

  Fly   173 DWMECVDLQIISNSECSRTYGT---QPDGILCVSTSGGKSTCSGDSGGPLVLHDGG------RLV 228
            |             ||...|.|   ..|..:|.....|..|..||||.||:...|.      .|.
  Fly   237 D-------------ECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLA 288

  Fly   229 GVTSWVSGNGCTAGLPSGFTRVTNQLDWIR 258
            |:||:..|.......|:.:|:.::..:||:
  Fly   289 GITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 69/278 (25%)
Tryp_SPc 37..260 CDD:238113 71/274 (26%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 71/274 (26%)
Tryp_SPc 62..317 CDD:214473 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.