DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and try-9

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:251 Identity:54/251 - (21%)
Similarity:81/251 - (32%) Gaps:89/251 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GLGFSGNGGWWCGGSIIAHDW-VLTAAH-----------CTNGASQVTIYYGATWRTNAQFTHT- 104
            |..||.|.....|...:...| ::||||           |..|..: ..|:...::....|.:. 
 Worm    16 GNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLR-EAYFVRDYKNFVAFVNVT 79

  Fly   105 ------------------------------VGSGDFIQNHNWPNQNGNDIALIRTPH-VDFWHMV 138
                                          ||.|..      ..::.||||:..... ::|...:
 Worm    80 CAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCI------DRESFNDIAVFELEEPIEFSKDI 138

  Fly   139 NKVELPSF-------NDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISN--SECSR--TY 192
            ....|||.       ...|.::        |:|...:.|.   :|...|:.:.:  :|||.  .|
 Worm   139 FPACLPSAPKIPRIRETGYKLF--------GYGRDPSDSV---LESGKLKSLYSFVAECSDDFPY 192

  Fly   193 GTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGR----LVGVTSWVSGNGCTAGLP 244
            |    |:.|.|......:|.||||..:|.....|    ||||.|        ||:|
 Worm   193 G----GVYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLS--------AGMP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 54/251 (22%)
Tryp_SPc 37..260 CDD:238113 54/251 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.