DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and KLK3

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:251 Identity:77/251 - (30%)
Similarity:118/251 - (47%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQV-----TIYY- 91
            |..|||.|:...:...|:.|.:...|..  .|||.::...||||||||....|.:     :::: 
Human    21 ILSRIVGGWECEKHSQPWQVLVASRGRA--VCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHP 83

  Fly    92 ---GATWRTNAQFTHTVGSGDFIQNH--NWPNQNGNDIALIR-TPHVDFWHMVNKVELPSFNDRY 150
               |..::.:..|.|.:.....::|.  ...:.:.:|:.|:| :...:....|..::||:.....
Human    84 EDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPAL 148

  Fly   151 NMYDNYWAVACGWG-------LTTAGSQPDWMECVDLQIISNSECSRTYGTQPDGI----LCVST 204
            ..    ...|.|||       ||     |..::||||.:|||..|::.:   |..:    ||...
Human   149 GT----TCYASGWGSIEPEEFLT-----PKKLQCVDLHVISNDVCAQVH---PQKVTKFMLCAGR 201

  Fly   205 -SGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRD 259
             :|||||||||||||||.:  |.|.|:|||.|........||.:|:|.:...||:|
Human   202 WTGGKSTCSGDSGGPLVCN--GVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 73/244 (30%)
Tryp_SPc 37..260 CDD:238113 75/247 (30%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.