DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and PRSS48

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:284 Identity:79/284 - (27%)
Similarity:114/284 - (40%) Gaps:66/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDW 73
            ::|:::|....|.|:          :.|:|.|..|..|:.|:.|.|.|..|  :.||||:::...
Human    33 ISLSSLSLVCGQPVY----------SSRVVGGQDAAAGRWPWQVSLHFDHN--FICGGSLVSERL 85

  Fly    74 VLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDF---------------IQNHNWPNQNGND 123
            :||||||..          .||.|   |::||..|..               |..|........|
Human    86 ILTAAHCIQ----------PTWTT---FSYTVWLGSITVGDSRKRVKYYVSKIVIHPKYQDTTAD 137

  Fly   124 IALIR-TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDW---MECVDLQIIS 184
            :||:: :..|.|...:..:.|||...:..:....|..  |||.....|..|:   ::..::.||.
Human   138 VALLKLSSQVTFTSAILPICLPSVTKQLAIPPFCWVT--GWGKVKESSDRDYHSALQEAEVPIID 200

  Fly   185 NSECSRTYGTQPDGI-------------LCV-STSGGKSTCSGDSGGPLVLHDGGRLV--GVTSW 233
            ...|.:.|  .|.||             :|. .|...|.:|.|||||||..|..|..:  ||.||
Human   201 RQACEQLY--NPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSW 263

  Fly   234 VSGNGCTAGLPSGFTRVTNQLDWI 257
              |..|...||..:|.|.....||
Human   264 --GLECGKSLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 73/255 (29%)
Tryp_SPc 37..260 CDD:238113 74/256 (29%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 73/255 (29%)
Tryp_SPc 51..288 CDD:238113 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.