DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and prss60.3

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:245 Identity:89/245 - (36%)
Similarity:122/245 - (49%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVT--IYYGATW 95
            :|.|||.|..|..|..|:.|.|.....||.:||||:|:.:||||||||.:|.|:.|  :|.|.  
Zfish    32 LNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGR-- 94

  Fly    96 RT----NAQFTHTVGSGDFIQNHNWPNQNGNDIALIR-TPHVDFWHMVNKVELPSFNDRYNMYDN 155
            ||    |...|....:..|:.:....|.|.|||||:| :..|.|.:.:..|.|.:.|..|:...:
Zfish    95 RTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSAGTS 159

  Fly   156 YWAVACGWGLTTAG---SQPDWMECVDLQIISNSECSRTY--GTQPDGILCVS-TSGGKSTCSGD 214
            .|..  |||...||   ..|..::...:.:::|..|:...  ||..:.::|.. |.|||.||.||
Zfish   160 SWIT--GWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGKDTCQGD 222

  Fly   215 SGGPLVLHDGGRL------VGVTSWVSGNGCT-AGLPSGFTRVTNQLDWI 257
            ||||:|.    ||      .|:|||  |.||. ...|..:|||:....||
Zfish   223 SGGPMVT----RLCTVWVQAGITSW--GYGCADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 86/240 (36%)
Tryp_SPc 37..260 CDD:238113 87/241 (36%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 87/241 (36%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.