DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG31220

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:233 Identity:71/233 - (30%)
Similarity:99/233 - (42%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGSIIAHDWVLTAAHC-TNGASQV---------------TIYYGATWRTNAQFTHTVGSGDFIQ 112
            ||||:|...:||||||| |:...|:               .|..||  |.....||.....:.|.
  Fly   139 CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGA--RIVCAPTHLDIDVESIT 201

  Fly   113 NHN-WPNQN---GNDIALIR----TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLT--- 166
            :|| :...|   .|||||:|    ..:...::.:..::.|....::.||      ..|||.|   
  Fly   202 SHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY------VAGWGKTGMF 260

  Fly   167 TAGSQPDWMECVDLQIISNSECSRTYGTQ---PDGILCVSTSGGKSTCSGDSGGPLVLHDGGR-- 226
            ..||:.  ::...:::....|||..|..:   |...:|......:.||.||||.|| :...||  
  Fly   261 DTGSKV--LKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPL-MGTSGRSY 322

  Fly   227 -----LVGVTSWVSGNGC-TAGLPSGFTRVTNQLDWIR 258
                 |.|:||:  |..| |.|.||.|||......|||
  Fly   323 ETITFLAGITSY--GGPCGTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 68/230 (30%)
Tryp_SPc 37..260 CDD:238113 71/233 (30%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 68/230 (30%)
Tryp_SPc 104..360 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.