DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG8952

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:272 Identity:91/272 - (33%)
Similarity:144/272 - (52%) Gaps:18/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIA 70
            ::.:.|||:|  .|.|..........||:.|||:|..|..|:.|:.|.|.........||||||:
  Fly     9 LMLVLLAAIS--VVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIIS 71

  Fly    71 HDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIRTPH-VDF 134
            ..|||||||||||.|.:.:.:|.....||...: :.|.:.|.:.::.::..||::||:.|. :.|
  Fly    72 DTWVLTAAHCTNGLSSIFLMFGTVDLFNANALN-MTSNNIIIHPDYNDKLNNDVSLIQLPEPLTF 135

  Fly   135 WHMVNKVEL-PSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECV---DLQIISNSECSRTYG-- 193
            ...:..::| ..:.|..: |....|...|:|. |.....|:.|.:   .::||.|::|...||  
  Fly   136 SANIQAIQLVGQYGDSID-YVGSVATIAGFGY-TEDEYLDYSETLLYAQVEIIDNADCVAIYGKY 198

  Fly   194 TQPDGILCVSTSGGK--STCSGDSGGPLVLHD----GGRLVGVTSWVSGNGCTAGLPSGFTRVTN 252
            ...|..:|.....|.  |||:|||||||:|::    ..:.:|:.|:|:.:.||..||||:.||::
  Fly   199 VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSS 263

  Fly   253 QLDWIRDNSGVA 264
            .|.:|.|.:|:|
  Fly   264 FLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 79/233 (34%)
Tryp_SPc 37..260 CDD:238113 79/235 (34%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 79/233 (34%)
Tryp_SPc 38..271 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471030
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.