DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and ctrb.1

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:232 Identity:84/232 - (36%)
Similarity:114/232 - (49%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQ 100
            |||||..|.....|:.|.|..| .|..:||||:|..:||:|||||....|...|.......:||:
Zfish    33 RIVNGEEARPHSWPWQVSLQDS-TGFHFCGGSLINENWVVTAAHCNVRTSHRVILGEHDRSSNAE 96

  Fly   101 FTHTVGSGDFIQNHNWPNQN----GNDIALIR--TPHVDFWHMVNKVELPSFNDRYNMYDNYWAV 159
            ...|:..|..|::   ||.|    .|||.||:  ||.....| |:.|.|...||  |.......|
Zfish    97 AIQTIAVGKSIKH---PNYNSFTINNDILLIKLATPAKINTH-VSPVCLAETND--NFPGGMKCV 155

  Fly   160 ACGWGLT--TAGSQPDWMECVDLQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLH 222
            ..|||||  .|...|..::...|.:::|.:|.|.:||....::..:.:.|.|:|.||||||||..
Zfish   156 TSGWGLTRYNAPDTPALLQQAALPLLTNDDCKRYWGTNITDLMICAGASGVSSCMGDSGGPLVCE 220

  Fly   223 DG--GRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
            :.  ..|||:.||.|.. |:...|:.:.|||....|:
Zfish   221 NNRVWTLVGIVSWGSST-CSTSTPAVYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 83/230 (36%)
Tryp_SPc 37..260 CDD:238113 83/231 (36%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 83/230 (36%)
Tryp_SPc 34..259 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.