DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Prss30

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:289 Identity:81/289 - (28%)
Similarity:114/289 - (39%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQV 87
            |.:|.       |:||.|..|.||:.|:.|.|..: ..|..||||:|...||||||||...:   
Mouse    67 HSRDA-------GKIVGGQDALEGQWPWQVSLWIT-EDGHICGGSLIHEVWVLTAAHCFRRS--- 120

  Fly    88 TIYYGATWRTNAQFTHTVGSG---DFIQNHN---------------WPNQNGNDIALIR------ 128
                     .|..|.|....|   ..::.|:               |.:.:..||||::      
Mouse   121 ---------LNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLR 176

  Fly   129 ----TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECS 189
                ||          |.||:...........|..  |||.|........::.:.:.::.:.:|.
Mouse   177 PSQFTP----------VCLPAAQTPLTPGTVCWVT--GWGATQERDMASVLQELAVPLLDSEDCE 229

  Fly   190 RTYGTQPDGI----------LCVS-TSGGKSTCSGDSGGPLV--LHDGGRLVGVTSWVSGNGCTA 241
            :.|.||...:          ||.. ..|.|.:|.||||||||  ::.....||:|||  |.||..
Mouse   230 KMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSW--GIGCAR 292

  Fly   242 GL-PSGFTRVTNQLDWIR----DNSGVAY 265
            .. |..:|||...:|||:    :|...||
Mouse   293 PYRPGVYTRVPTYVDWIQRILAENHSDAY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 73/262 (28%)
Tryp_SPc 37..260 CDD:238113 75/268 (28%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.