DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Mcpt2

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:239 Identity:70/239 - (29%)
Similarity:102/239 - (42%) Gaps:38/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVNGYPAYEGKAPYTVGLGFSGNGGW--WCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNA 99
            |:.|..:.....||...|......|.  .|||.:|:..:|||||||.  ..::|:..||      
  Rat    21 IIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHCK--GREITVILGA------ 77

  Fly   100 QFTHTVGSGDFIQN---------HNWPNQ--NGNDIALIR-TPHVDFWHMVNKVELPSFNDRYNM 152
               |.|...:..|.         |...|.  |.:||.|:: ...|:....||.|.|||.:|..:.
  Rat    78 ---HDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVELTPAVNVVPLPSPSDFIHP 139

  Fly   153 YDNYWAVACGWGLTTAGSQPDW-MECVDLQIISNSEC--SRTYGTQPDGILCV-STSGGKSTCSG 213
            ....|  |.|||.|.......: :..|:|:|:....|  .|.|..:..  :|| |.:..::...|
  Rat   140 GAMCW--AAGWGKTGVRDPTSYTLREVELRIMDEKACVDYRYYEYKFQ--VCVGSPTTLRAAFMG 200

  Fly   214 DSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
            ||||||:.  .|...|:.|:...:   |..|:.||||:..:.||
  Rat   201 DSGGPLLC--AGVAHGIVSYGHPD---AKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 68/237 (29%)
Tryp_SPc 37..260 CDD:238113 70/239 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 68/237 (29%)
Tryp_SPc 21..242 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.