DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Prss34

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:109/259 - (42%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVNGYPAYEGKAPYTVGLGFSGN--GGW--WCGGSIIAHDWVLTAAHCTN-----------GASQ 86
            ||.|.|....:.|:.|.|.|...  ..|  .||||:|...||||||||..           ...|
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly    87 VTIYYGATWRTNAQF---THTVGSGDFIQNHNWPNQNGNDIALIRTPH-VDFWHMVNKVELPSFN 147
            :.:|      .|.|.   ...:....|.:..:.|  .|.||||::... |.....|:.|.||:.:
  Rat    98 LRLY------ENDQLMKVAKIIRHPKFSEKLSAP--GGADIALLKLDSTVVLSERVHPVSLPAAS 154

  Fly   148 DRYNMYDNYWAVACGWGLTTAGSQPDWMEC----VDLQIISNSECSRTYGTQ----------PDG 198
            .|.:....:|  ..|||: ..|.:|....|    |.:.|:.||:|.:.|.|.          .|.
  Rat   155 QRISSKKTWW--VAGWGV-IEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDD 216

  Fly   199 ILCVSTSGGKSTCSGDSGGPLVL--HDGGRLVGVTSWVSGNGCTAGL---PSGFTRVTNQLDWI 257
            :||.... |:.:|..|||||||.  :.....|||.||  |.||  ||   |..:|||.:.|.||
  Rat   217 MLCAGME-GRDSCQADSGGPLVCRWNCSWVQVGVVSW--GIGC--GLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 80/257 (31%)
Tryp_SPc 37..260 CDD:238113 82/259 (32%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 82/259 (32%)
Tryp_SPc 33..275 CDD:214473 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.