DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Prss30

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:258 Identity:82/258 - (31%)
Similarity:113/258 - (43%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYY----GATW 95
            |:||.|..|.||:.|:.|.|. :...|..||||:|...||||||||.......:.|:    |.|.
  Rat    29 GKIVGGQDAPEGRWPWQVSLR-TEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTL 92

  Fly    96 R-TNAQFTHTVGSGDFI-QNHNWPNQNGNDIALIR--TPHVDFWHMVNKVELPSFNDRYNMYDNY 156
            . |....|.......|: ..:.|.:.:..||||:|  ||...  ...:.|.||............
  Rat    93 SLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQP--SQFSPVCLPQAQAPLTPGTVC 155

  Fly   157 WAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYG-----------TQPDGILCVS-TSGGKS 209
            |..  |||.|........::.:.:.::.:.:|.|.|.           .|.| :||.. ..|.|.
  Rat   156 WVT--GWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSD-MLCAGFVEGQKD 217

  Fly   210 TCSGDSGGPLV--LHDGGRLVGVTSWVSGNGCT-AGLPSGFTRVTNQLDWIR----DNSGVAY 265
            :|.||||||||  ::.....||:|||  |.||. ...|..:|||.:.:|||:    :|...||
  Rat   218 SCQGDSGGPLVCAINSSWIQVGITSW--GIGCARPNKPGVYTRVPDYVDWIQRTLAENHSDAY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 76/243 (31%)
Tryp_SPc 37..260 CDD:238113 78/249 (31%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.