DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG30286

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:110/250 - (44%) Gaps:53/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTV 105
            :.|:..::|:...|..||.  ..|||:::.|.::||||||......:|:..|       :|....
  Fly    39 HQAHISESPWMAYLHKSGE--LVCGGTLVNHRFILTAAHCIREDENLTVRLG-------EFNSLT 94

  Fly   106 G-----------SGDF-----IQNHNWPNQNG-NDIALIRTP-------HVDFWHMVNKVELPSF 146
            .           |.||     .::..:...|. :||.|:|..       |:....::....|...
  Fly    95 SIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPK 159

  Fly   147 NDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTY--GTQPDGILCVSTSGGKS 209
            .:|.:.     .||.|||.:.:.:....::.:.:..::...||:||  ..:.|.| |||...|.|
  Fly   160 IERLHR-----LVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQI-CVSHESGVS 218

  Fly   210 TCSGDSGGPL---VLHDGGRL---VGVTSWVSGNG-CTAGLPSGFTRVTNQLDWI 257
             ||||||||:   :..||..|   ||:.|:  ||. |.:  ||.||.|...:|||
  Fly   219 -CSGDSGGPMGQAIRLDGRVLFVQVGIVSY--GNAECLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 68/248 (27%)
Tryp_SPc 37..260 CDD:238113 69/249 (28%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 69/249 (28%)
Tryp_SPc 39..268 CDD:214473 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.