DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG30098

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:228 Identity:58/228 - (25%)
Similarity:89/228 - (39%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGSIIAHDWVLTAAHCTNGASQVTIYYGA--TWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIAL 126
            ||||:||:.:||||||||.....:.:..|.  :.||....|.:.......::.|:.:...:|||:
  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAV 124

  Fly   127 IRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVAC--------------------GWG-LTTAGS 170
            ::.                  ||..:||.|....|                    ||| :.....
  Fly   125 LKL------------------DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYK 171

  Fly   171 QPDWMECVDLQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLV------- 228
            .|..::.:.|:.:.|..|    |.....|.|.:..  :..|.|||||||     |.||       
  Fly   172 MPTTLQEMSLRRVRNEYC----GVPSLSICCWNPV--QYACFGDSGGPL-----GSLVKYGHKTI 225

  Fly   229 ----GVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
                |||:.|:|| |..  .|.:..:.:.:.|:
  Fly   226 YVQFGVTNSVTGN-CDG--YSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 57/226 (25%)
Tryp_SPc 37..260 CDD:238113 58/228 (25%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 57/225 (25%)
Tryp_SPc 37..258 CDD:238113 58/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.