DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG30091

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:111/260 - (42%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQ 100
            :||.|..|.|.|.|:...:  ..|..:.||||:|.:.:|||||||.....:..:.|       .|
  Fly    36 KIVGGVDAGELKNPWMALI--KTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKY-------TQ 91

  Fly   101 FTHTVG------SGDFIQNHNWPN----------------QN-GNDIALIRTPHVDFWHMVNKVE 142
            .|.|:|      :|:    ||.|:                || .|||||:|...    .:|.|.:
  Fly    92 LTVTLGVYHLLATGE----HNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQK----SIVYKPQ 148

  Fly   143 LPS----FNDRY----NMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQPD-G 198
            :..    .||:.    ::...:.|:  |||:|..|...:.::.|.:..|....|...:....| .
  Fly   149 IKPLCILLNDQLKPQTDLIQEFTAI--GWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYP 211

  Fly   199 ILCVSTSGGKSTCSGDSGGPLVLH---DG---GRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
            :.|..|:.|:.||..||||||.:|   ||   ...:|:.|  :|.....|. ..:|.|...:|:|
  Fly   212 MFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS--TGTEDCRGF-GMYTDVMGHIDFI 273

  Fly   258  257
              Fly   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 72/258 (28%)
Tryp_SPc 37..260 CDD:238113 73/259 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 72/258 (28%)
Tryp_SPc 37..276 CDD:238113 73/259 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.