DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG30088

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:106/277 - (38%) Gaps:89/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGAT 94
            ::.:..|||.|..|....||:...|.:|..  ..|||:||:..::||||||.....:|.:     
  Fly    38 ESNVATRIVRGKEAMLKSAPFMAYLYYSSE--IHCGGTIISSRYILTAAHCMRPYLKVRL----- 95

  Fly    95 WRTNAQFTHTVGSGDFIQNHNWPNQNG--------------------------NDIALIRTPHVD 133
                       |..|..:|   |:..|                          |||||::.    
  Fly    96 -----------GEHDITRN---PDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKL---- 142

  Fly   134 FWHMVNKVELPSFNDRYNMY--------------DNYWAVACGWGLTTAGSQPDWMECVDLQIIS 184
                       |.|.|:|::              :.:...|.|||.|......:.::...|....
  Fly   143 -----------SRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYD 196

  Fly   185 NSECSRTYGTQPDGI--LCVSTSGGKSTCSGDSGGPLVL---HDG---GRLVGVTSWVSGNGCTA 241
            |..| |:..:.|..|  |||... |..|||||||||||.   :||   ...:|:.|: ..:.|.:
  Fly   197 NRHC-RSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSF-GDDKCQS 258

  Fly   242 GLPSGFTRVTNQLDWIR 258
              |..:|.|.|.:.|||
  Fly   259 --PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 70/268 (26%)
Tryp_SPc 37..260 CDD:238113 72/270 (27%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 70/268 (26%)
Tryp_SPc 45..273 CDD:238113 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.