DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG30087

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:68/258 - (26%)
Similarity:104/258 - (40%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCT------------------- 81
            |:|||..|....||:.|.:  :.|....|||||:...::||||||.                   
  Fly    41 RVVNGKEAVIRSAPFMVYV--TNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDC 103

  Fly    82 --NGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR-------TPHVD-FWH 136
              :..|..:..||.......:|.:..       ||      .|||||::       ..|:. ...
  Fly   104 QGSNCSPRSEEYGIMKAITHRFYNAA-------NH------VNDIALLKLNRSINFNVHIQPICI 155

  Fly   137 MVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQPDGILC 201
            ::|....||    ...|..:     |||.|.....|..::..:|:....:.|||::....:|...
  Fly   156 LLNPASAPS----VATYQTF-----GWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQI 211

  Fly   202 VSTSGGKSTCSGDSGGPLVLH---DGGR---LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIR 258
            .:....:.||:||||||||..   ||.:   .:|:.|: ....|.:  |..:|.|.|.::|||
  Fly   212 CAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSY-GPTDCQS--PGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 65/255 (25%)
Tryp_SPc 37..260 CDD:238113 67/257 (26%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 65/255 (25%)
Tryp_SPc 42..272 CDD:238113 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.