DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG30082

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:258 Identity:68/258 - (26%)
Similarity:100/258 - (38%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKIN----GRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYY 91
            |.||    .|||.|..|..|..|:...|  ..|....|.|::|...:|||||||.:....:|:..
  Fly    30 TTINLPPTNRIVGGRTADIGSNPWLAYL--HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRL 92

  Fly    92 G-------------------ATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR-TPHVDFWH 136
            |                   ..:.....:.||...|        ...:.|||.|:: ...|.:..
  Fly    93 GEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGG--------RQDSRNDIGLLKLNGTVVYKL 149

  Fly   137 MVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQPD-GIL 200
            .:..:.|  |.|...:..:....|.|||.....:....::.|:|..:..|:|.|:..|... |..
  Fly   150 FIRPICL--FRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQF 212

  Fly   201 CVSTSGGKSTCSGDSGGPLVLH-DGGRL-----VGVTSWVSGNGCTAGLPSGFTRVTNQLDWI 257
            |.. .....||||||||||... ..||:     :|:.|:  |:....| |..:|.|.:..:||
  Fly   213 CAG-QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY--GHYLCRG-PGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 63/247 (26%)
Tryp_SPc 37..260 CDD:238113 64/248 (26%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 63/247 (26%)
Tryp_SPc 40..274 CDD:238113 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.930

Return to query results.
Submit another query.