DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Ctrb1

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:294 Identity:89/294 - (30%)
Similarity:132/294 - (44%) Gaps:78/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVVLALALAAVSA------ETVQQVHPKDLPKDTKING--RIVNGYPAYEGKAPYTVGL----GF 56
            |:.|....|.|.|      .|:|.|          :.|  |||||..|..|..|:.|.|    ||
  Rat     3 FLWLVSCFALVGATFGCGVPTIQPV----------LTGLSRIVNGEDAIPGSWPWQVSLQDKTGF 57

  Fly    57 SGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPN--- 118
            .     :||||:|:.|||:|||||....|.|.:                 :|:|.|..:..|   
  Rat    58 H-----FCGGSLISEDWVVTAAHCGVKTSDVVV-----------------AGEFDQGSDEENIQV 100

  Fly   119 -------QN--------GNDIALIR--TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVAC---GW 163
                   :|        .|||.|::  || ..|...|:.|.||:.:|.:..     ...|   ||
  Rat   101 LKIAQVFKNPKFNMFTVRNDITLLKLATP-AQFSETVSAVCLPNVDDDFPP-----GTVCATTGW 159

  Fly   164 GLT--TAGSQPDWMECVDLQIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGG- 225
            |.|  .|...|:.::...|.|:|.::|.:::|::...::..:.:.|.|:|.||||||||....| 
  Rat   160 GKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGV 224

  Fly   226 -RLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIR 258
             .|.|:.||.|| .|:...|:.::|||..:.|::
  Rat   225 WTLAGIVSWGSG-VCSTSTPAVYSRVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 79/251 (31%)
Tryp_SPc 37..260 CDD:238113 79/253 (31%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 79/251 (31%)
Tryp_SPc 34..259 CDD:238113 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.