DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and TPSD1

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:249 Identity:69/249 - (27%)
Similarity:97/249 - (38%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWW---CGGS 67
            :|.|||..:::.......|....:.|    .||.|..|...|.|:.|.|..  .|.:|   ||||
Human    11 LLLLALPVLASPAYVAPAPGQALQQT----GIVGGQEAPRSKWPWQVSLRV--RGPYWMHFCGGS 69

  Fly    68 IIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWP------------NQN 120
            :|...||||||||.    :..|...|..|...:..|.     :.|:...|            .|.
Human    70 LIHPQWVLTAAHCV----EPDIKDLAALRVQLREQHL-----YYQDQLLPVSRIIVHPQFYIIQT 125

  Fly   121 GNDIALIRTPH-VDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAG---SQPDWMECVDLQ 181
            |.||||:.... |:....::.|.||..::.:......|..  |||.....   ..|..::.|::.
Human   126 GADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVT--GWGDVDNNVHLPPPYPLKEVEVP 188

  Fly   182 IISNSECSRTYGT----------QPDGILCVSTSGGKSTCSGDSGGPLVLHDGG 225
            ::.|..|:..|.|          ..|.:||.. |....:|.||||||||....|
Human   189 VVENHLCNAEYHTGLHTGHSFQIVRDDMLCAG-SENHDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 63/219 (29%)
Tryp_SPc 37..260 CDD:238113 63/218 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 63/218 (29%)
Tryp_SPc 38..240 CDD:214473 62/215 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.