DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and T22A3.6

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:256 Identity:50/256 - (19%)
Similarity:85/256 - (33%) Gaps:103/256 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIA 125
            |.||   .:.:|   |.|.|              ::.....|.|  |.||:    ..|::|    
 Worm   155 GPWC---YVGND---TTAPC--------------FQPCRPSTET--SSDFV----CLNRDG---- 189

  Fly   126 LIRTPHVDFWHMVNKVELPS----FNDRYNMYDNYWAVACGWGLTTAGSQPDWME------CVDL 180
               .|:.|: .|.:.::||.    |.|...||::.:.:.         |.||.::      |::.
 Worm   190 ---FPYTDY-DMSDILDLPQLIGIFKDVDLMYESRFVLP---------SLPDGVQRLSTKSCINK 241

  Fly   181 QIISN--------------------------SECSRTYG-----TQPDGILC-------VSTSGG 207
            ..|:|                          ..|..::.     |...|||.       ::.||.
 Worm   242 GHIANHFGPWIAVLDQTATQFLAAAGRRKLRDLCFPSFNEHEIFTYQQGILLDAIIEDELTISGC 306

  Fly   208 K------STCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQ-LDWIRDNS 261
            .      |:|..|.....:....|......:.|||..|   :|  :|:.|:: |..::.||
 Worm   307 TFWRRCFSSCQDDLATCWLKSQKGYFGSKATSVSGKQC---IP--WTQATSEILSMVKVNS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 48/250 (19%)
Tryp_SPc 37..260 CDD:238113 48/253 (19%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.