Sequence 1: | NP_001033873.1 | Gene: | Jon25Bi / 33708 | FlyBaseID: | FBgn0020906 | Length: | 266 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492773.3 | Gene: | T22A3.6 / 188711 | WormBaseID: | WBGene00011909 | Length: | 491 | Species: | Caenorhabditis elegans |
Alignment Length: | 256 | Identity: | 50/256 - (19%) |
---|---|---|---|
Similarity: | 85/256 - (33%) | Gaps: | 103/256 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 GWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIA 125
Fly 126 LIRTPHVDFWHMVNKVELPS----FNDRYNMYDNYWAVACGWGLTTAGSQPDWME------CVDL 180
Fly 181 QIISN--------------------------SECSRTYG-----TQPDGILC-------VSTSGG 207
Fly 208 K------STCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQ-LDWIRDNS 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon25Bi | NP_001033873.1 | Tryp_SPc | 36..257 | CDD:214473 | 48/250 (19%) |
Tryp_SPc | 37..260 | CDD:238113 | 48/253 (19%) | ||
T22A3.6 | NP_492773.3 | KR | 98..173 | CDD:350900 | 7/37 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |