DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Tpsb2

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:290 Identity:88/290 - (30%)
Similarity:127/290 - (43%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWW-- 63
            :|..::|..||:.:::    .|:....|.:.::.  ||.|:.|.|.|.|:.|.|.|..|  :|  
Mouse     2 LKRLLLLLWALSLLAS----LVYSAPRPANQRVG--IVGGHEASESKWPWQVSLRFKLN--YWIH 58

  Fly    64 -CGGSIIAHDWVLTAAHCTN-----------GASQVTIYYG-ATWRTNAQFTHTVGSGDFIQNHN 115
             ||||:|...||||||||..           ...:..:||| .....|....|.         |.
Mouse    59 FCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHP---------HY 114

  Fly   116 WPNQNGNDIAL--IRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGS---QPDWM 175
            :..:.|.|:||  :..| |:....::.:.||..::.:....:.|..  |||......   .|..:
Mouse   115 YTAEGGADVALLELEVP-VNVSTHLHPISLPPASETFPPGTSCWVT--GWGDIDNDEPLPPPYPL 176

  Fly   176 ECVDLQIISNSECSRTYGT----------QPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLV-- 228
            :.|.:.|:.||.|.|.|.|          ..||:||...: .:.:|.||||||||....|..:  
Mouse   177 KQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNT-RRDSCQGDSGGPLVCKVKGTWLQA 240

  Fly   229 GVTSWVSGNGCT-AGLPSGFTRVTNQLDWI 257
            ||.||  |.||. ...|..:||||..||||
Mouse   241 GVVSW--GEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 80/253 (32%)
Tryp_SPc 37..260 CDD:238113 82/254 (32%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.