DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CTRL

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:239 Identity:78/239 - (32%)
Similarity:124/239 - (51%) Gaps:17/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWR-TNA 99
            |||||..|..|..|:.|.|..| :|..:||||:|:..||:|||||.....:..:..|...| :||
Human    33 RIVNGENAVLGSWPWQVSLQDS-SGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNA 96

  Fly   100 QFTHTVGSGDFIQNHNWPNQN-GNDIALIR--TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVAC 161
            :....:.....|.:.:|.:.. .||:.|::  :| ..:...::.|.|.|.|:.  :.:....|..
Human    97 EPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASP-AQYTTRISPVCLASSNEA--LTEGLTCVTT 158

  Fly   162 GWG-LTTAGS-QPDWMECVDLQIISNSECSRTYGTQ-PDGILCVSTSGGKSTCSGDSGGPLVLHD 223
            ||| |:..|: .|..::.|.|.:::.::|.:.:|:. .|.::|.. ..|.|:|.||||||||...
Human   159 GWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAG-GAGASSCQGDSGGPLVCQK 222

  Fly   224 GGR--LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSGVAY 265
            |..  |:|:.||.:.| |....|:.:|||:....||  |..:||
Human   223 GNTWVLIGIVSWGTKN-CNVRAPAVYTRVSKFSTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 73/229 (32%)
Tryp_SPc 37..260 CDD:238113 74/231 (32%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.