DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and CG43336

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:279 Identity:71/279 - (25%)
Similarity:105/279 - (37%) Gaps:78/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGAS 85
            :.|...:|       |:.||..|....:|:...| .|.:|.:.||||:|.:..|||||||....:
  Fly    29 RAHSPSVP-------RVKNGTVASLTSSPWMAFL-HSTDGRFICGGSLITNRLVLTAAHCFLDRT 85

  Fly    86 QVTIYYGATWRTNAQFTH----------TVGSGDFIQNHNWPNQNGNDIALIRTPHVDFWHMVNK 140
            ::....|...|...:..|          .|..| |...|..|.....|||::|        :..|
  Fly    86 ELVARLGEYDREEYEMCHDSYCTYRIEAMVERG-FRHRHYNPMTMAYDIAILR--------LYRK 141

  Fly   141 VELPSFNDRYN----MYDNYW---------AVACGWGLTTAGSQPDWMECVDLQIISNSECSRTY 192
            |:   :.|...    :.|..|         ....|||.|.:......:..||| ...:.|..|.|
  Fly   142 VQ---YTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDL-ARKHPEVCRRY 202

  Fly   193 GTQPDGILCVSTSGGK--------STCSGDSGGPLVLHDGGRL-----------VGVTSWVSGNG 238
            .|       :|.:..:        :.|:||||||:     |.|           ||:.|: :...
  Fly   203 AT-------LSLTANQFCAGNERSNLCNGDSGGPV-----GALIPYGKSKRFVQVGIASF-TNTQ 254

  Fly   239 CTAGLPSGFTRVTNQLDWI 257
            |.  :.|.||.|.:.:|||
  Fly   255 CV--MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 67/262 (26%)
Tryp_SPc 37..260 CDD:238113 68/263 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 67/262 (26%)
Tryp_SPc 40..271 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.